PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC06G01050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 679aa    MW: 74097.7 Da    PI: 8.5049
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC06G01050.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.13.5e-24428472145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+ep+rCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  OPUNC06G01050.1 428 DPEPWRCRRTDGKKWRCSKEAHPDSKYCERHMHRGRNRSRKPVES 472
                      79****************************************986 PP

2QLQ576e-20354388236
              QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                       FTaaQ+++L++Q+l+yKyL+a++PvP +Ll++i+
  OPUNC06G01050.1 354 VFTAAQWAELEQQALIYKYLVAGVPVPGDLLLPIR 388
                      5********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005037.9E-1871186IPR006011Syntaxin, N-terminal domain
SuperFamilySSF476615.1E-4176287IPR010989t-SNARE
Gene3DG3DSA:1.20.58.705.7E-4276287No hitNo description
SMARTSM003972.1E-14227294IPR000727Target SNARE coiled-coil homology domain
PROSITE profilePS5019217.57232294IPR000727Target SNARE coiled-coil homology domain
CDDcd158451.15E-29236293No hitNo description
PROSITE patternPS009140238277IPR006012Syntaxin/epimorphin, conserved site
PfamPF057395.6E-10268305IPR000727Target SNARE coiled-coil homology domain
SMARTSM009514.6E-10353389IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.187354389IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.6E-14355388IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166726.346428472IPR014977WRC domain
PfamPF088799.5E-21429471IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006886Biological Processintracellular protein transport
GO:0007030Biological ProcessGolgi organization
GO:0007034Biological Processvacuolar transport
GO:0009306Biological Processprotein secretion
GO:0016192Biological Processvesicle-mediated transport
GO:0061025Biological Processmembrane fusion
GO:1900150Biological Processregulation of defense response to fungus
GO:0005634Cellular Componentnucleus
GO:0005768Cellular Componentendosome
GO:0005802Cellular Componenttrans-Golgi network
GO:0016020Cellular Componentmembrane
GO:0005484Molecular FunctionSNAP receptor activity
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 679 aa     Download sequence    Send to blast
MATRNRTPLY RKYRDALRHV RAPAGAPSSS SSSGGGGGGG PVIEMASLLR SDRPYAPLST  60
DDPSAASSRG AVTVGLPPAW VDVSEEISAN MQRARTKMAE LAKAHAKALM PSFGDGRDDQ  120
RAIEILTHEV TDLLKKSEKR LQKLSMKDSS EDSNVRKNVQ RSLATDLQSL SMEFRKKQST  180
YLKQLRQQKE GQDGVDLEMN MNGSKSTFEL GDDEFEDVGF TEVQMSKLKK SEAFTRERER  240
EIEQVVESVN ELAQIMKDLS VLVIDQGTII DRIDYNIQNV AASVEEGYKQ LQKAERTQKK  300
GGMVMKGKTQ DFAPAKAGHE EAGNATEPKG GSSPSAAAAA VGMGGYQQQR GAAVFTAAQW  360
AELEQQALIY KYLVAGVPVP GDLLLPIRPH SAAAAATYSF SNPAAAPFYH HHHHPSLSYY  420
AYYGKKLDPE PWRCRRTDGK KWRCSKEAHP DSKYCERHMH RGRNRSRKPV ESKTAAPAPQ  480
SQPQLSNVTT ATHDADAPLP SLTVGAKTHG LSLGGAGSSQ FHVDAPSYGS KYSLGAKADV  540
GELSFFSGAS GNTRGFTIDS PTDSSWHSLP SSVPPYPMSK PRDSGLLPGA YSYSHLEPSQ  600
ELGQVTIASL SQEQERRSFG GGAGGMLGNV KHENQPLRPF FDEWPGRRDS WSEMDEERSN  660
QTSFSTTQLS ISIPMPRCD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1035080.0AK103508.1 Oryza sativa Japonica Group cDNA clone:J033131E19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641605.10.0PREDICTED: growth-regulating factor 5 isoform X4
SwissprotQ6AWY40.0GRF5_ORYSJ; Growth-regulating factor 5
TrEMBLA0A0E0L7330.0A0A0E0L733_ORYPU; Uncharacterized protein
STRINGBGIOSGA022056-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.13e-27growth-regulating factor 5